PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1AL_28010F812.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 204aa    MW: 23506.3 Da    PI: 11.9775
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1AL_28010F812.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.41.9e-14351148
                           TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                           +g+W++eEd l+++ ++++G g +W   ++t+g++R++ +c+srw++yl
  Traes_1AL_28010F812.1  3 KGKWSKEEDNLIKNHIEKYGIGcSWQGLSNTLGLRRCGRSCRSRWLNYL 51
                           79*********************************************97 PP

2Myb_DNA-binding38.23.2e-1258101247
                            SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                            g++T+ Ed ++ +  ++ G+  W+ Ia++++ gRt+  +k++w++ 
  Traes_1AL_28010F812.1  58 GNFTPAEDRIICEMYRKKGSC-WSVIAAELP-GRTDLAIKNYWNST 101
                            89*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.028151IPR017930Myb domain
SuperFamilySSF466891.31E-25298IPR009057Homeodomain-like
SMARTSM007171.5E-9253IPR001005SANT/Myb domain
PfamPF002495.5E-12351IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-19458IPR009057Homeodomain-like
PROSITE profilePS5129421.67652106IPR017930Myb domain
SMARTSM007171.1E-1256104IPR001005SANT/Myb domain
PfamPF002494.4E-1158101IPR001005SANT/Myb domain
CDDcd001676.94E-959102No hitNo description
Gene3DG3DSA:1.10.10.604.5E-2259106IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MKKGKWSKEE DNLIKNHIEK YGIGCSWQGL SNTLGLRRCG RSCRSRWLNY LRPGLKHGNF  60
TPAEDRIICE MYRKKGSCWS VIAAELPGRT DLAIKNYWNS TLKKQLPRKX XXXXXXXXXX  120
XXXXXXXXXT RRAPAAPRGT SHWSCATRMT VPLPPRRGTS LCSRTTSTRR APRLGPRRAT  180
PAPSRPDRRC KRVPNRRRCP PPPR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-24110625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014661280.11e-65PREDICTED: transcription factor RAX2-like
SwissprotQ9FKL21e-41MYB36_ARATH; Transcription factor MYB36
TrEMBLW4ZMT01e-126W4ZMT0_WHEAT; Uncharacterized protein
STRINGOB10G21860.11e-61(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122282638
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37780.12e-32myb domain protein 87
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]